Ground Beef Stir Fry - Easy Weeknight Recipe
30-MINUTE MEALS! Get the email series now
Royal Recipe

Ground Beef Stir Fry

5 from 1 vote
1 Comments
Emily Kate
By: Emily KateUpdated: Mar 20, 2026
This post may contain affiliate links. Please read our disclosure policy.

A quick, family-friendly stir fry with lean ground beef, crisp vegetables, and a savory-sweet sauce—ready in about 30 minutes and perfect over rice or noodles.

Ground Beef Stir Fry

This Ground Beef Stir Fry became a weekday staple the first cold week I tried to use up odds and ends in my fridge. I discovered the combination by tossing a pound of lean ground beef with whatever vegetables I had on hand and a simple pantry sauce, and the result was unexpectedly bright and comforting. The dish finishes with glossy sauce clinging to small bites of beef and tender-crisp vegetables—there's a satisfying contrast of textures and a gentle balance between savory, sweet, and umami that gets everyone at the table to reach for seconds.

I remember serving this the first time to a tired young family down the street who had stopped by unannounced; within minutes the kitchen was full of warm aromas and laughter. The bell pepper and broccoli keep the plate colorful and add crunch, while the mushrooms add an earthy rounded note. It’s quick enough for a weeknight, flexible for substitutions, and scales easily for guests—everything I love in a dependable dinner.

Why You'll Love This Recipe

  • This is genuinely fast: most of the active work takes under 30 minutes, making it ideal for busy weeknights or last-minute plans.
  • It uses pantry staples and flexible vegetables, so you can adapt it to what you have on hand and avoid extra grocery trips.
  • The sauce is both sweet and savory—brown sugar, hoisin, and soy build umami while vinegar brightens the finish so the dish never tastes flat.
  • Lean ground beef cooks quickly and breaks into small, family-friendly pieces that pair well with rice or noodles and are easy for picky eaters to enjoy.
  • It’s great for meal prep: make a double batch and portion it into containers for ready lunches or dinners through the week.
  • Simple garnishes like sesame seeds and scallions make the plate look professional without extra fuss.

When I first tested this recipe I swapped vegetables based on what my CSA box sent that week; my husband loved the extra mushrooms so much that they became a constant addition. Our kids like the familiar texture of ground beef and often request this with a sprinkle of sesame seeds—small rituals like that are how a quick dinner becomes a family favorite.

Ingredients

  • Ground beef (1 pound): Use lean ground beef (90% lean suggested) for less splatter and a cleaner sauce; it browns nicely without releasing excessive fat. Look for fresh meat from a reputable brand or your local butcher—ground beef labeled "lean" keeps the dish lighter while still delivering protein and flavor.
  • Olive oil (1 tablespoon): A neutral-tasting oil will prevent sticking when sautéing vegetables; extra-virgin olive oil is fine but a light olive or vegetable oil tolerates higher heat with less flavor interference.
  • Onion (1/2 medium): Cut into bite-size pieces to provide sweetness and a soft base; yellow or sweet onions work best for caramelized notes.
  • Mushrooms (5 ounces, cremini suggested): Quartered mushrooms add an earthy depth; cremini are my favorite because they brown well and have a slightly richer flavor than button mushrooms.
  • Red bell pepper (1 medium): Chopped into bite-size pieces for color, sweetness, and a crunchy contrast to the soft beef; red peppers are sweeter than green and add a vibrant hue.
  • Broccoli (2 cups florets): Cut small so they cook quickly and remain tender-crisp; fresh broccoli gives the best color and snap—blanching is optional but not necessary.
  • Matchstick carrots (1/2 cup): Provide a subtle sweetness and bright color; matchstick cuts are ideal for quick cooking and consistent texture.
  • Salt & pepper: Season to taste at the end; use kosher salt if you have it and freshly ground black pepper for a cleaner finish.
  • Optional garnishes: Chopped scallions and sesame seeds brighten the plate and add a toasty finish—use white or black sesame seeds depending on your presentation preference.
  • Sauce components: Brown sugar (2 tablespoons) balances the savory notes; fresh ginger (1 teaspoon, grated) and garlic (2 cloves, minced) provide aromatics; hoisin sauce (3 tablespoons) and soy sauce (2 tablespoons) add umami; vinegar (1 teaspoon) brightens—use rice vinegar or apple cider if you prefer a fruitier tang. Beef broth or water (1/2 cup) thins the sauce and prevents it from burning, while cornstarch (1 tablespoon) creates a glossy, clingy finish.

Instructions

Prep and make the sauce:Measure and chop all vegetables so everything is ready to go. In a small bowl whisk together brown sugar, grated ginger, minced garlic, hoisin, soy sauce, vinegar, beef broth (or water), and cornstarch until smooth—this prevents lumps and ensures the sauce thickens evenly when added to the hot pan.Brown the beef:Heat a large skillet over medium-high heat and add the ground beef. Cook for about 8–10 minutes, breaking the meat up with a wooden spoon so it browns evenly. Look for little brown bits forming—those Maillard flavors are key. Cook until there’s no pink left and juices run clear.Drain and set aside:Carefully drain off any excess fat into a heatproof container and transfer the beef to a plate or bowl. Removing excess fat keeps the sauce from becoming greasy and allows the vegetables to sauté rather than steam.Sauté the aromatics:Return the skillet to medium heat and add the olive oil. Add the onion and sauté for about 1 minute until the edges start to soften and smell sweet. This short sauté builds a mellow base without overcooking the onion.Add the vegetables:Add mushrooms, bell pepper, broccoli, and matchstick carrots. Stir often and cook 3–4 minutes until vegetables are tender-crisp—broccoli should be bright green and slightly firm. If you prefer softer vegetables, cook an additional 2–3 minutes, but avoid overcooking to preserve texture and nutrients.Combine and thicken:Return the browned beef to the skillet and pour the sauce over everything. Stir well and bring to a gentle boil so the cornstarch can activate; simmer for 1–2 minutes until the sauce becomes glossy and coats the meat and vegetables. Taste and adjust with salt and pepper as needed.Serve:Serve immediately over steamed rice or noodles and garnish with chopped scallions and a sprinkle of sesame seeds for color and crunch.User provided content image 1

You Must Know

  • This dish stores well in the refrigerator for up to 4 days in an airtight container and freezes for up to 3 months—reheat gently to avoid overcooking the vegetables.
  • Nutrition-wise it’s protein-forward; using lean beef lowers saturated fat and keeps the plate balanced when served with whole-grain rice or a green salad.
  • To keep the sauce gluten-free, substitute tamari for soy sauce and look for a gluten-free hoisin alternative; otherwise hoisin typically contains wheat.
  • Use low-sodium soy sauce if you are watching salt intake and taste before adding extra salt at the end.

My favorite thing about this dish is how forgiving it is. The first time I made it I swapped broccoli for green beans and it still delivered excellent texture and flavor; later I learned that giving the vegetables a quick high-heat toss preserves their color and crunch, which is an instant sign of a well-made stir fry. Family and friends often ask for the sauce recipe because it’s savory with just enough sweetness to be universally appealing.

Storage Tips

Store leftovers in shallow airtight containers so food cools quickly and evenly; refrigerate within two hours of cooking. The stir fry will keep for up to 4 days in the refrigerator. For longer storage, portion into freezer-safe containers and freeze for up to 3 months—label with the date. When reheating, thaw overnight in the refrigerator if frozen, then reheat gently in a skillet with a splash of water or broth over medium heat to restore moisture and preserve vegetable texture. Microwaving works for single servings; cover loosely and reheat in 30-second bursts, stirring between intervals.

Ingredient Substitutions

If you need to adapt the ingredients: replace ground beef with ground turkey or ground chicken for a lighter option; note that cooking times may be slightly shorter and the flavor milder, so boost umami with an extra tablespoon of hoisin. Swap broccoli for snap peas or green beans for similar crunch. If you’re vegetarian, use crumbled firm tofu or a plant-based ground alternative and switch beef broth to vegetable broth. For a gluten-free version choose tamari and a certified gluten-free hoisin. To reduce sugar, cut the brown sugar to 1 tablespoon and compensate with a splash of extra vinegar for brightness.

User provided content image 2

Serving Suggestions

Serve over steamed white rice, brown rice, or your favorite noodles—egg noodles or udon make for a hearty plate. For a lighter meal, present it atop a bed of mixed greens or cauliflower rice. Garnish with chopped scallions, a sprinkle of sesame seeds, or a drizzle of toasted sesame oil for extra aroma. For family-style dinners, offer bowls of pickled cucumbers or a simple cabbage slaw to add a crisp, acidic counterpoint. Pair with a light beer or a chilled jasmine tea to balance the dish’s sweet and savory notes.

Cultural Background

While not a traditional dish from any single Asian cuisine, this stir-fried preparation borrows techniques and flavors common to East Asian home cooking—quick high-heat cooking, a balance of savory and sweet, and the use of aromatics like ginger and garlic. Cremini mushrooms and hoisin sauce nod toward Chinese-style flavors, but the method is rooted in practical weeknight cooking: fast, flexible, and reliant on readily available pantry ingredients. The approach mirrors how many home cooks around the world adapt classic techniques to local tastes and produce.

Seasonal Adaptations

Adapt the vegetables to the season: in spring use snap peas and asparagus; in summer add zucchini and cherry tomatoes at the end for a burst of freshness; in fall swap in roasted squash and kale for heartier texture; in winter use root vegetables and cauliflower. Small changes in vegetables and a squeeze of citrus can update the dish for holidays—serve with roasted garlic mashed potatoes in cooler months for a comfort-forward twist.

Meal Prep Tips

Double the batch and portion into individual containers with rice for effortless lunches. Pack garnishes separately to keep food fresh—store scallions and sesame seeds in a small container and add just before eating. If freezing portions, leave out rice until reheating, as cooked rice changes texture when frozen and reheated. When reheating, stir in 1–2 tablespoons of water or broth per portion to revive the sauce and prevent dryness.

Whether you’re feeding a hungry family or building a fridge-ready weekly rotation, this stir fry is a reliable, flavorful solution that invites creativity. I hope it becomes one of your go-to meals as it did for mine—simple, comforting, and endlessly adaptable.

Pro Tips

  • Whisk the sauce thoroughly before adding to the pan to prevent cornstarch lumps and ensure even thickening.

  • Cook vegetables at high heat and stir frequently to keep them tender-crisp and bright in color.

  • Drain excess fat from the beef to prevent a greasy sauce and to help the vegetables sauté instead of steam.

  • Taste and adjust salt after the sauce thickens—soy and hoisin are already salty and can intensify as the sauce reduces.

  • If the sauce is too thick, thin with a splash of beef broth or water and heat through for another minute.

This nourishing ground beef stir fry recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I make this gluten-free?

Yes. You can use tamari and a gluten-free hoisin to make the dish gluten-free. Also check labels for hidden gluten in packaged sauces.

How long will leftovers last?

Yes, leftovers keep 3–4 days in the refrigerator in an airtight container and freeze up to 3 months.

Tags

Simple Pleasuresrecipebeefstir-fryweeknightdinnervegetables
No ratings yet

Ground Beef Stir Fry

This Ground Beef Stir Fry recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Ground Beef Stir Fry
Prep:15 minutes
Cook:15 minutes
Rest Time:10 mins
Total:30 minutes

Ingredients

Main

Sauce

Instructions

1

Prepare ingredients and sauce

Chop all vegetables into bite-size pieces and whisk together brown sugar, grated ginger, minced garlic, hoisin, soy sauce, vinegar, beef broth, and cornstarch in a small bowl until smooth.

2

Brown the beef

Heat a large skillet over medium-high heat and add the ground beef. Cook about 8–10 minutes, breaking up the meat until no pink remains and juices run clear, then drain excess fat.

3

Sauté aromatics

Return the skillet to medium heat, add olive oil, and sauté the onion for about 1 minute until edges soften and aroma develops.

4

Cook the vegetables

Add mushrooms, bell pepper, broccoli, and matchstick carrots. Stir frequently and cook 3–4 minutes until vegetables are tender-crisp, cooking a few minutes longer if a softer texture is preferred.

5

Combine beef and sauce

Return the drained beef to the skillet, pour the prepared sauce over the ingredients, and stir to combine. Bring to a simmer so the cornstarch can thicken the sauce, about 1–2 minutes.

6

Finish and serve

Taste and adjust seasoning with salt and pepper, then serve immediately over rice or noodles and garnish with chopped scallions and sesame seeds.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 360kcal | Carbohydrates: 20g | Protein:
30g | Fat: 18g | Saturated Fat: 5g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
7g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@cravele on social media!

Ground Beef Stir Fry

Categories:

Ground Beef Stir Fry

Did You Make This?

Leave a comment & rating below or tag @cravele on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Emily!

Chef and recipe creator specializing in delicious Simple Pleasures cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.