Apple Pancakes with Vanilla Maple Syrup - Cozy Breakfast
30-MINUTE MEALS! Get the email series now
Royal Recipe

Apple Pancakes with Vanilla Maple Syrup

5 from 1 vote
1 Comments
Emily Kate
By: Emily KateUpdated: Sep 13, 2026
This post may contain affiliate links. Please read our disclosure policy.

Light, cinnamon-spiced pancakes studded with grated apple and finished with a warm vanilla maple syrup. A cozy breakfast that feels special but is easy enough for weeknights.

Apple Pancakes with Vanilla Maple Syrup

This apple pancake recipe has been a weekend ritual in my kitchen for years. I first pulled the idea together one crisp autumn morning when I had an overripe apple and a pantry of basic staples. The result was so comforting that the stack disappeared before I could set the table. These pancakes are tender with a slightly chewy edge, gently spiced with cinnamon and nutmeg, and flecked with fresh apple for moisture and brightness. The warm vanilla maple syrup is simple yet transformative. It melts into the pancakes and makes every forkful taste like a small celebration.

I love this version because it balances convenience and flavor. The batter comes together in one bowl and requires only a grater for the apple. The apple keeps the pancakes moist so they do not dry out while sitting in a low oven, which is helpful when cooking for a crowd. I often double the batch for guests and keep extras warm on a sheet pan set in a 200 degrees Fahrenheit oven. Family members request these for birthdays, lazy Sundays, and whenever we need something that smells like autumn in the house.

Why You'll Love This Recipe

  • Ready with minimal prep in about 25 minutes from start to finish which makes it a great weekday breakfast or a relaxed weekend treat.
  • Uses pantry staples and one fresh apple so you rarely need special shopping; the recipe is forgiving and easy to scale.
  • The batter is mixed just until combined so the pancakes remain tender and not gummy; small lumps in the batter ensure a light crumb.
  • Warm vanilla maple syrup is stirred together in seconds and elevates the pancakes without complicated steps; option to add vanilla bean for a gourmet touch.
  • Make-ahead friendly: keep cooked pancakes in a low oven while finishing the batch or freeze extras for quick reheating in a toaster or oven.
  • Family friendly and approachable for cooks of any skill level with clear visual cues for doneness.

In my experience these pancakes reliably win over picky eaters. The grated apple hides easily inside the pancakes, delivering a gentle apple note rather than big chunks. When I first served these for a holiday brunch, a friend told me they tasted like the apple pie of her childhood but in pancake form. That memory has made me love serving them to new people because they instantly feel familiar and special.

Ingredients

  • All-purpose flour: 1 cup. Use a trusted brand such as King Arthur or Gold Medal. Sifting is optional but stir the flour before measuring to avoid packing and to keep the batter light.
  • Light brown sugar: 2 tablespoons packed. The molasses in brown sugar deepens the spice notes and helps with browning; pack it into the spoon for accurate measure.
  • Baking powder: 1 teaspoon. Fresh, active baking powder is essential for lift so check the date on the can.
  • Warm spices: 2 teaspoons ground cinnamon, 1/2 teaspoon ground nutmeg, 1/2 teaspoon ground clove. These provide the cozy aroma; if you prefer a subtler profile reduce cinnamon to 1 teaspoon as in the original note.
  • Milk and egg: 1 cup whole milk and 1 large egg. Whole milk gives richness; swap for 2 percent if preferred but the texture will be slightly lighter.
  • Butter and vanilla: 1 tablespoon unsalted butter, melted and cooled, and 1 teaspoon vanilla extract. The butter adds flavor and tenderness while vanilla rounds the syrup and batter flavors.
  • Apple: 1 cup grated apple, about 1 medium apple. A firm, crisp variety such as Honeycrisp or Fuji works best; grate on the medium side of a box grater and do not squeeze out the juices.
  • Skillet fat: Butter or vegetable oil for the skillet. Use about 1 1/2 teaspoons butter or 1 teaspoon oil per batch for a lightly crisp edge.
  • Vanilla maple syrup: about 1/2 cup pure maple syrup warmed and 1 teaspoon vanilla extract or the scrapings of 1 vanilla bean for an intense aroma.

Instructions

Combine dry ingredientsIn a medium bowl whisk together 1 cup all-purpose flour, 2 tablespoons packed light brown sugar, 1 teaspoon baking powder, 2 teaspoons ground cinnamon, 1/2 teaspoon ground nutmeg, 1/2 teaspoon ground clove, and 1/8 teaspoon salt. Whisking aerates the flour and evenly distributes the leavening and spices so each pancake rises consistently. Look for a uniform color and no visible clumps of brown sugar.Mix wet ingredientsIn a measuring cup or small bowl measure 1 cup whole milk and add 1 large egg, 1 tablespoon melted unsalted butter cooled slightly, and 1 teaspoon vanilla extract. Beat lightly until homogeneous. The cooled butter prevents cooking the egg and the combined wet ingredients should be smooth and glossy.Combine wet and dryPour the wet mixture into the dry ingredients all at once and stir gently until just combined. The batter should show small to medium lumps; stop mixing as soon as you see them. Overmixing develops gluten and yields dense pancakes. If batter seems too thick add up to 1 tablespoon more milk to reach a pourable but slightly thick consistency.Fold in appleGently fold in 1 cup grated apple. The apple adds moisture and a faint texture; do not squeeze out juices. The grated pieces will soften and distribute throughout the pancakes during cooking.Preheat and grease skilletPreheat a heavy skillet or nonstick pan over medium heat. Brush or melt 1 1/2 teaspoons butter or add 1 teaspoon vegetable oil to the pan. The skillet is ready when a drop of batter sizzles gently on contact. Adjust heat so pancakes do not burn too quickly.Cook the pancakesUsing a 1/4-cup measure scoop batter onto the warm skillet. Cook 1 to 2 minutes until small bubbles appear and edges set, then flip. Reduce heat to medium-low after flipping and cook the second side about 1 minute until golden brown. If you make slightly larger pancakes they may take a bit longer; watch for a uniformly golden color, not deep brown spots.Keep warm and repeatTransfer finished pancakes to a baking sheet and hold in a 200 degrees Fahrenheit oven while you finish the batch. Re-grease pan with more butter or oil as needed. Serve immediately with warm vanilla maple syrup.Make the syrupWarm about 1/2 cup pure maple syrup gently in a small saucepan or microwave and stir in 1 teaspoon vanilla extract or the scrapings of 1 vanilla bean. Do not boil. The warm syrup melds with the pancakes and enhances the apple and spice notes.User provided content image 1

You Must Know

  • These pancakes hold well in a 200 degrees Fahrenheit oven for up to 30 minutes without drying out which is ideal when making larger batches.
  • Freeze extras flat on a sheet pan, then transfer to a zip bag for up to three months. Reheat in a toaster or 350 degrees Fahrenheit oven until warmed through.
  • The dish is high in carbohydrates from flour and maple syrup and contains dairy and eggs so it is not suitable for vegan or strict dairy free diets.
  • Use a medium grater for the apple to ensure quick cooking and even distribution of moisture rather than large chunks which can make pancakes soggy in the center.

My favorite thing about this preparation is how reliably it evokes a cozy morning. Friends have told me these pancakes remind them of apple pie without the work. The syrup with vanilla bean scrapings is a small extra step that makes a big sensory difference, giving the stack a homemade bakery aroma that guests always compliment.

Storage Tips

Store leftover cooked pancakes in an airtight container in the refrigerator for up to three days. To freeze, arrange pancakes in a single layer on a tray and freeze until firm, then stack with parchment between layers in a freezer bag for up to three months. Reheat frozen pancakes in a 350 degrees Fahrenheit oven for 8 to 12 minutes or in a toaster until hot. For best texture avoid microwaving from frozen as it can make them gummy; if microwaving, add 10 to 20 seconds and finish in a hot skillet for crisp edges.

Ingredient Substitutions

Swap whole milk for 2 percent or for oat milk to make the batter dairy free but note texture will be slightly less rich. Replace unsalted butter with coconut oil for a paler flavor that still crisps. For gluten free use a one-to-one gluten free baking flour and add a teaspoon of xanthan gum if your blend lacks it. Reduce brown sugar by half for a less sweet profile and increase vanilla extract by a quarter teaspoon to maintain aroma.

User provided content image 2

Serving Suggestions

Serve stacks with a pat of butter and a generous spoonful of warm vanilla maple syrup. Add toasted pecans or walnuts for crunch, or a dollop of Greek yogurt for tang. For a brunch spread pair with scrambled eggs, smoked bacon, or a crisp green salad to balance sweetness. Garnish with thin apple slices, a light dusting of powdered sugar, or a few cinnamon sugar sprinkles for a festive touch.

Cultural Background

Pancakes are a global comfort food with regional variations from thin French cr pes to thick American-style griddled cakes. Adding apple nods to autumn harvest traditions in North America where fruit was often incorporated into morning fare. The maple syrup accompaniment is rooted in the culinary history of northeastern regions where maple sap was a key sweetener. Combining simple pantry items with seasonal fruit is a classic technique that spans cultures and generations.

Seasonal Adaptations

In fall use tart apples such as Granny Smith for a brighter contrast; in winter swap apple for pear and add a pinch of ground ginger. For summer, fold in a handful of diced blueberries or strawberries and reduce cinnamon to one teaspoon. Holiday versions can include a splash of bourbon in the syrup or toasted chopped pecans and a cinnamon orange zest topping for festive aroma.

Meal Prep Tips

Double the batter and cook pancakes in batches, keeping finished stacks warm in a low oven. Portion into individual containers for grab-and-go breakfasts and refrigerate for up to three days. To reheat, use a nonstick skillet over medium heat and return the pancakes to the pan with a small pat of butter to re-crisp the edges while warming through.

These apple pancakes are simple to adapt and always feel like a treat. I hope you enjoy making them as much as I enjoy sharing them. Whether it is a quiet morning or a celebratory brunch, this recipe invites delicious memories and a warm kitchen atmosphere.

Pro Tips

  • Grate the apple on the medium side of a box grater; do not squeeze out the juices to keep the batter moist.

  • Hold cooked pancakes in a 200 degrees Fahrenheit oven on a sheet pan to keep them warm and prevent drying.

  • If batter seems thick after mixing, add 1 tablespoon of milk at a time until it reaches a pourable consistency.

  • Use fresh baking powder for reliable lift and light texture.

This nourishing apple pancakes with vanilla maple syrup recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Simple Pleasuresrecipebreakfastpancakesapplemaple-syrupcomfort-food
No ratings yet

Apple Pancakes with Vanilla Maple Syrup

This Apple Pancakes with Vanilla Maple Syrup recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 3 steaks
Apple Pancakes with Vanilla Maple Syrup
Prep:10 minutes
Cook:15 minutes
Rest Time:10 mins
Total:25 minutes

Ingredients

Pancakes

Vanilla Maple Syrup

Instructions

1

Combine dry ingredients

Whisk together flour, brown sugar, baking powder, cinnamon, nutmeg, clove, and salt in a medium bowl until evenly mixed and aerated.

2

Mix wet ingredients

In a measuring cup or small bowl combine milk, egg, melted cooled butter, and vanilla. Beat lightly until smooth and uniform.

3

Combine wet and dry

Add the wet mixture to the dry ingredients all at once and stir gently until just combined. Small to medium lumps should remain; avoid overmixing.

4

Fold in apple

Gently fold in the grated apple so it distributes evenly without releasing excess juice. The grated apple will add moisture and texture.

5

Preheat skillet

Heat a heavy skillet over medium and brush with butter or oil. The pan is ready when a drop of batter sizzles upon contact.

6

Cook pancakes

Using a 1/4-cup measure, drop batter onto the skillet and cook 1 to 2 minutes until small bubbles form and edges set. Flip and reduce heat to medium-low and cook the second side about 1 minute until golden.

7

Keep warm

Transfer cooked pancakes to a baking sheet and hold in a 200 degrees Fahrenheit oven while you finish the rest to keep them warm without drying out.

8

Make syrup and serve

Warm maple syrup gently and stir in vanilla extract or vanilla bean scrapings. Drizzle over pancakes and serve immediately with butter if desired.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 420kcal | Carbohydrates: 60g | Protein:
7g | Fat: 14g | Saturated Fat: 4g |
Polyunsaturated Fat: 3g | Monounsaturated Fat:
6g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@cravele on social media!

Apple Pancakes with Vanilla Maple Syrup

Categories:

Apple Pancakes with Vanilla Maple Syrup

Did You Make This?

Leave a comment & rating below or tag @cravele on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Emily!

Chef and recipe creator specializing in delicious Simple Pleasures cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.